Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Rickettsia rickettsii [TaxId:392021] [226679] (1 PDB entry) |
Domain d4jgaa1: 4jga A:7-266 [223806] automated match to d1ox0a1 complexed with edo, k, na |
PDB Entry: 4jga (more details), 2.1 Å
SCOPe Domain Sequences for d4jgaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jgaa1 c.95.1.0 (A:7-266) automated matches {Rickettsia rickettsii [TaxId: 392021]} nkrvvitglglvtpvglnvnsswknivdgvsgiktitefdtsklackiaglidnsekdgf klenftqaddinrlskmdkfihygvaaateavedsgwlpddeksrdrtglilgsgigglk miedtsiklyqenngkvspffipaslinllsglvsikygfsgpnqtavtacstgahaigd amrmikhgyadvmiaggaeapvtpvgvagfvaaralctkyndnpkkasrpwdkdrsgfvm gegagvvvleeyehalnrga
Timeline for d4jgaa1: