![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (12 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [224854] (11 PDB entries) |
![]() | Domain d4jg1l2: 4jg1 L:108-214 [223805] Other proteins in same PDB: d4jg1l1 automated match to d1rhha2 complexed with ppi |
PDB Entry: 4jg1 (more details), 1.55 Å
SCOPe Domain Sequences for d4jg1l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jg1l2 b.1.1.2 (L:108-214) automated matches {Escherichia coli [TaxId: 562]} rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d4jg1l2: