SCOPe 2.03: Domain d4jfzl2: 4jfz L:108-214

Lineage for d4jfzl2 (4jfz L:108-214)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [224854] (11 PDB entries)

8. Domain d4jfzl2: 4jfz L:108-214 [223801]
   Other proteins in same PDB: d4jfzl1
   automated match to d1rhha2
   complexed with ppi

Details for d4jfzl2

PDB Entry: 4jfz, 1.75 Å

PDB Description: structure of phosphoserine (psab) scaffold bound to pser peptide

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4jfzl2:

Sequence; same for both SEQRES and ATOM records:

>d4jfzl2 b.1.1.2 (L:108-214) automated matches {Escherichia coli [TaxId: 562]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4jfzl2:

• d4jfzl2 is new in SCOPe 2.03-stable
  
• d4jfzl2 appears in SCOPe 2.04
  
• d4jfzl2 appears in the current release, SCOPe 2.08