| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
| Protein automated matches [191209] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189839] (58 PDB entries) |
| Domain d4jfma1: 4jfm A:16-140 [223789] Other proteins in same PDB: d4jfma2 automated match to d4drja_ complexed with 1kz |
PDB Entry: 4jfm (more details), 1.02 Å
SCOPe Domain Sequences for d4jfma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jfma1 d.26.1.1 (A:16-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne
pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell
dfkge
Timeline for d4jfma1: