SCOPe 2.03: Domain d4jfma_: 4jfm A:

Lineage for d4jfma_ (4jfm A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (33 PDB entries)

8. Domain d4jfma_: 4jfm A: [223789]
   automated match to d4drja_
   complexed with 1kz

Details for d4jfma_

PDB Entry: 4jfm, 1.02 Å

PDB Description: Increasing the Efficiency Efficiency of Ligands for the FK506-Binding Protein 51 by Conformational Control: Complex of FKBP51 with 2-(3,4-dimethoxyphenoxy)ethyl (2S)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4jfma_:

Sequence; same for both SEQRES and ATOM records:

>d4jfma_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge

Timeline for d4jfma_:

• d4jfma_ is new in SCOPe 2.03-stable
  
• d4jfma_ appears in SCOPe 2.04
  
• d4jfma_ appears in the current release, SCOPe 2.08, called d4jfma1