Lineage for d4jfma1 (4jfm A:16-140)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941584Protein automated matches [191209] (6 species)
    not a true protein
  7. 2941590Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries)
  8. 2941595Domain d4jfma1: 4jfm A:16-140 [223789]
    Other proteins in same PDB: d4jfma2
    automated match to d4drja_
    complexed with 1kz

Details for d4jfma1

PDB Entry: 4jfm (more details), 1.02 Å

PDB Description: Increasing the Efficiency Efficiency of Ligands for the FK506-Binding Protein 51 by Conformational Control: Complex of FKBP51 with 2-(3,4-dimethoxyphenoxy)ethyl (2S)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4jfma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jfma1 d.26.1.1 (A:16-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne
pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell
dfkge

SCOPe Domain Coordinates for d4jfma1:

Click to download the PDB-style file with coordinates for d4jfma1.
(The format of our PDB-style files is described here.)

Timeline for d4jfma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jfma2