Lineage for d4jfka_ (4jfk A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408349Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1408560Protein automated matches [191209] (3 species)
    not a true protein
  7. 1408561Species Human (Homo sapiens) [TaxId:9606] [189839] (33 PDB entries)
  8. 1408574Domain d4jfka_: 4jfk A: [223787]
    automated match to d4drja_
    complexed with jfk

Details for d4jfka_

PDB Entry: 4jfk (more details), 1.15 Å

PDB Description: Increasing the Efficiency Efficiency of Ligands for the FK506-Binding Protein 51 by Conformational Control: Complex of FKBP51 with (1S,6R)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-10-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]-3,10-diazabicyclo[4.3.1]decan-2-one
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4jfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jfka_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge

SCOPe Domain Coordinates for d4jfka_:

Click to download the PDB-style file with coordinates for d4jfka_.
(The format of our PDB-style files is described here.)

Timeline for d4jfka_: