SCOPe 2.04: Domain d4jfhe2: 4jfh E:117-244

Lineage for d4jfhe2 (4jfh E:117-244)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d4jfhe2: 4jfh E:117-244 [223784]
   Other proteins in same PDB: d4jfhd1, d4jfhe1
   automated match to d1qsee2
   complexed with edo, gol, so4

Details for d4jfhe2

PDB Entry: 4jfh, 2.4 Å

PDB Description: High Affinity alpha24-beta17 T Cell Receptor for A2 HLA-Melanoma peptide complex

PDB Compounds: (E:) beta17 TCR allele

SCOPe Domain Sequences for d4jfhe2:

Sequence; same for both SEQRES and ATOM records:

>d4jfhe2 b.1.1.2 (E:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d4jfhe2:

• d4jfhe2 first appeared in SCOPe 2.03
  
• d4jfhe2 appears in SCOPe 2.05
  
• d4jfhe2 appears in the current release, SCOPe 2.08