Lineage for d4jfhd1 (4jfh D:1-110)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512892Domain d4jfhd1: 4jfh D:1-110 [223781]
    Other proteins in same PDB: d4jfhd2, d4jfhe1, d4jfhe2
    automated match to d1qrnd1
    complexed with edo, gol, so4

Details for d4jfhd1

PDB Entry: 4jfh (more details), 2.4 Å

PDB Description: High Affinity alpha24-beta17 T Cell Receptor for A2 HLA-Melanoma peptide complex
PDB Compounds: (D:) alpha24 TCR allele

SCOPe Domain Sequences for d4jfhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jfhd1 b.1.1.1 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkeveqnsgplsvpegaiaslnctysflgsqsffwyrqysgkspelimftyregdkedgr
ftaqlnkasqhvsllirdsqpsdsatylcavndggrltfgdgttltvkpn

SCOPe Domain Coordinates for d4jfhd1:

Click to download the PDB-style file with coordinates for d4jfhd1.
(The format of our PDB-style files is described here.)

Timeline for d4jfhd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jfhd2