SCOP 1.55: Domain d1f0lb1: 1f0l B:381-535

Lineage for d1f0lb1 (1f0l B:381-535)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (1 family)

5. Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)

6. Protein Diphtheria toxin, C-terminal domain [49382] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [49383] (6 PDB entries)

8. Domain d1f0lb1: 1f0l B:381-535 [22378]
   Other proteins in same PDB: d1f0la2, d1f0la3, d1f0lb2, d1f0lb3

Details for d1f0lb1

PDB Entry: 1f0l, 1.55 Å

PDB Description: 1.55 angstrom crystal structure of wild type diphtheria toxin

SCOP Domain Sequences for d1f0lb1:

Sequence; same for both SEQRES and ATOM records:

>d1f0lb1 b.2.1.1 (B:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Timeline for d1f0lb1:

• d1f0lb1 appears in SCOP 1.57
  
• d1f0lb1 appears in the current release, SCOPe 2.08