SCOPe 2.08: Domain d4jesa_: 4jes A:

Lineage for d4jesa_ (4jes A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
   beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432

4. Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families)

5. Family d.35.1.0: automated matches [196913] (1 protein)
   not a true family

6. Protein automated matches [196914] (3 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [196915] (3 PDB entries)

8. Domain d4jesa_: 4jes A: [223778]
   automated match to d4jeta_
   complexed with mli, na, p6g, tam

Details for d4jesa_

PDB Entry: 4jes, 1.6 Å

PDB Description: 1.6a resolution apo structure of the hemophore hasa from yersinia pestis (hexagonal form)

PDB Compounds: (A:) hemophore hasa

SCOPe Domain Sequences for d4jesa_:

Sequence, based on SEQRES records:

>d4jesa_ d.35.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh
snpegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl
sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd

Sequence, based on observed residues (ATOM records):

>d4jesa_ d.35.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh
snpegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggagkhlekiditfneldlsg
efdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd

Timeline for d4jesa_:

• d4jesa_ first appeared in SCOPe 2.03
  
• d4jesa_ appears in SCOPe 2.07