SCOPe 2.03: Domain d4jebb_: 4jeb B:

Lineage for d4jebb_ (4jeb B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (2 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (29 PDB entries)

8. Domain d4jebb_: 4jeb B: [223773]
   automated match to d3m15a_
   complexed with hem, zn

Details for d4jebb_

PDB Entry: 4jeb, 2.3 Å

PDB Description: Crystal structure of an engineered RIDC1 tetramer with four interfacial disulfide bonds and four three-coordinate Zn(II) sites

PDB Compounds: (B:) Soluble cytochrome b562

SCOPe Domain Sequences for d4jebb_:

Sequence; same for both SEQRES and ATOM records:

>d4jebb_ a.24.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemad
frhgfwiligqihaalhlancgkvkeaqaaaeqlkctcnachqkyr

Timeline for d4jebb_:

• d4jebb_ is new in SCOPe 2.03-stable
  
• d4jebb_ appears in SCOPe 2.04
  
• d4jebb_ appears in the current release, SCOPe 2.08