SCOPe 2.06: Domain d4je9a_: 4je9 A:

Lineage for d4je9a_ (4je9 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (39 PDB entries)

8. Domain d4je9a_: 4je9 A: [223766]
   automated match to d3m79a_
   complexed with hem

Details for d4je9a_

PDB Entry: 4je9, 2.12 Å

PDB Description: Crystal structure of an engineered metal-free RIDC1 construct with four interfacial disulfide bonds

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d4je9a_:

Sequence; same for both SEQRES and ATOM records:

>d4je9a_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr

Timeline for d4je9a_:

• d4je9a_ first appeared in SCOPe 2.03
  
• d4je9a_ appears in SCOPe 2.05
  
• d4je9a_ appears in SCOPe 2.07
  
• d4je9a_ appears in the current release, SCOPe 2.08