SCOPe 2.08: Domain d4je9a_: 4je9 A:

Lineage for d4je9a_ (4je9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein Cytochrome b562 [47177] (1 species)

7. Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)

8. Domain d4je9a_: 4je9 A: [223766]
   automated match to d3m79a_
   complexed with hem

Details for d4je9a_

PDB Entry: 4je9, 2.12 Å

PDB Description: Crystal structure of an engineered metal-free RIDC1 construct with four interfacial disulfide bonds

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d4je9a_:

Sequence; same for both SEQRES and ATOM records:

>d4je9a_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr

Timeline for d4je9a_:

• d4je9a_ first appeared in SCOPe 2.03
  
• d4je9a_ appears in SCOPe 2.07