Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries) |
Domain d4jdvl1: 4jdv L:1-103 [223764] Other proteins in same PDB: d4jdvb2, d4jdvl2 automated match to d1rhha1 complexed with 144, 1pe, gol, so4 |
PDB Entry: 4jdv (more details), 1.65 Å
SCOPe Domain Sequences for d4jdvl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jdvl1 b.1.1.1 (L:1-103) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleik
Timeline for d4jdvl1: