SCOPe 2.03: Domain d4jdvb1: 4jdv B:2-103

Lineage for d4jdvb1 (4jdv B:2-103)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)

8. Domain d4jdvb1: 4jdv B:2-103 [223762]
   Other proteins in same PDB: d4jdvb2, d4jdvl2
   automated match to d1rhha1
   complexed with 144, 1pe, gol, so4

Details for d4jdvb1

PDB Entry: 4jdv, 1.65 Å

PDB Description: crystal structure of germ-line precursor of nih45-46 fab

PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d4jdvb1:

Sequence; same for both SEQRES and ATOM records:

>d4jdvb1 b.1.1.1 (B:2-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipar
fsgsgsgtdftltisslepedfavyycqqyeffgqgtkleik

Timeline for d4jdvb1:

• d4jdvb1 is new in SCOPe 2.03-stable
  
• d4jdvb1 appears in SCOPe 2.04
  
• d4jdvb1 appears in the current release, SCOPe 2.08