Class b: All beta proteins [48724] (178 folds) |
Fold b.76: open-sided beta-meander [51086] (2 superfamilies) single sheet formed by beta-hairpin repeats; exposed on both sides in the middle |
Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) 11+ stranded sheet partly folded upon itself at the C-end |
Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein) |
Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries) Uniprot Q8WTS6 52-366 |
Domain d4jdsd1: 4jds D:116-193 [223760] Other proteins in same PDB: d4jdsa2, d4jdsa3, d4jdsb2, d4jdsb3, d4jdsc2, d4jdsc3, d4jdsd2, d4jdsd3 automated match to d1n6ca1 complexed with 1l4, sam, unx |
PDB Entry: 4jds (more details), 1.7 Å
SCOPe Domain Sequences for d4jdsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jdsd1 b.76.2.1 (D:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst eegrphfelmpgnsvyhf
Timeline for d4jdsd1: