SCOP 1.57: Domain d1cwva4: 1cwv A:796-886

Lineage for d1cwva4 (1cwv A:796-886)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (1 family)

5. Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)

6. Protein Invasin [49377] (1 species)

7. Species Yersinia pseudotuberculosis [TaxId:633] [49378] (1 PDB entry)

8. Domain d1cwva4: 1cwv A:796-886 [22376]
   Other proteins in same PDB: d1cwva5

Details for d1cwva4

PDB Entry: 1cwv, 2.3 Å

PDB Description: crystal structure of invasin: a bacterial integrin-binding protein

SCOP Domain Sequences for d1cwva4:

Sequence; same for both SEQRES and ATOM records:

>d1cwva4 b.1.14.1 (A:796-886) Invasin {Yersinia pseudotuberculosis}
ptltgilvngqnfatdkgfpktifknatfqlqmdndvanntqyewsssftpnvsvndqgq
vtityqtysevavtakskkfpsysvsyrfyp

Timeline for d1cwva4:

• d1cwva4 first appeared (with stable ids) in SCOP 1.55
  
• d1cwva4 appears in SCOP 1.59
  
• d1cwva4 appears in the current release, SCOPe 2.08