SCOPe 2.05: Domain d4jdsc2: 4jds C:194-370

Lineage for d4jdsc2 (4jds C:194-370)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (17 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d4jdsc2: 4jds C:194-370 [223759]
   Other proteins in same PDB: d4jdsa1, d4jdsb1, d4jdsc1, d4jdsd1
   automated match to d3cbpa2
   complexed with 1l4, sam, unx

Details for d4jdsc2

PDB Entry: 4jds, 1.7 Å

PDB Description: SETD7 in complex with inhibitor PF-5426 and S-adenosyl-methionine

PDB Compounds: (C:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4jdsc2:

Sequence, based on SEQRES records:

>d4jdsc2 b.85.7.1 (C:194-370) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqkhhhh

Sequence, based on observed residues (ATOM records):

>d4jdsc2 b.85.7.1 (C:194-370) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydeapewyqvelkafqatqqkhhhh

Timeline for d4jdsc2:

• d4jdsc2 first appeared in SCOPe 2.03
  
• d4jdsc2 appears in SCOPe 2.04
  
• d4jdsc2 appears in SCOPe 2.06
  
• d4jdsc2 appears in the current release, SCOPe 2.08