SCOPe 2.06: Domain d4jdsc1: 4jds C:117-193

Lineage for d4jdsc1 (4jds C:117-193)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (18 PDB entries)
   Uniprot Q8WTS6 52-366

8. Domain d4jdsc1: 4jds C:117-193 [223758]
   Other proteins in same PDB: d4jdsa2, d4jdsa3, d4jdsb2, d4jdsb3, d4jdsc2, d4jdsc3, d4jdsd2, d4jdsd3
   automated match to d1n6ca1
   complexed with 1l4, sam, unx

Details for d4jdsc1

PDB Entry: 4jds, 1.7 Å

PDB Description: SETD7 in complex with inhibitor PF-5426 and S-adenosyl-methionine

PDB Compounds: (C:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4jdsc1:

Sequence; same for both SEQRES and ATOM records:

>d4jdsc1 b.76.2.1 (C:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

Timeline for d4jdsc1:

• d4jdsc1 first appeared in SCOPe 2.03
  
• d4jdsc1 appears in SCOPe 2.05
  
• d4jdsc1 appears in SCOPe 2.07
  
• d4jdsc1 appears in the current release, SCOPe 2.08