Lineage for d4jdpb1 (4jdp B:1-263)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527523Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2527524Protein automated matches [190447] (55 species)
    not a true protein
  7. 2527538Species Archaeoglobus fulgidus [TaxId:2234] [189636] (2 PDB entries)
  8. 2527540Domain d4jdpb1: 4jdp B:1-263 [223753]
    Other proteins in same PDB: d4jdpb2
    automated match to d3qgmc_
    complexed with cl, mg

Details for d4jdpb1

PDB Entry: 4jdp (more details), 1.76 Å

PDB Description: Crystal structure of probable p-nitrophenyl phosphatase (pho2) (target EFI-501307) from Archaeoglobus fulgidus DSM 4304 with Magnesium bound
PDB Compounds: (B:) p-nitrophenyl phosphatase (Pho2)

SCOPe Domain Sequences for d4jdpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jdpb1 c.108.1.0 (B:1-263) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mmpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrs
fglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvv
gsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdv
vvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldq
mierhglkpdyvfnslkdmveal

SCOPe Domain Coordinates for d4jdpb1:

Click to download the PDB-style file with coordinates for d4jdpb1.
(The format of our PDB-style files is described here.)

Timeline for d4jdpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jdpb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4jdpa_