Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [189636] (2 PDB entries) |
Domain d4jdpb1: 4jdp B:1-263 [223753] Other proteins in same PDB: d4jdpb2 automated match to d3qgmc_ complexed with cl, mg |
PDB Entry: 4jdp (more details), 1.76 Å
SCOPe Domain Sequences for d4jdpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jdpb1 c.108.1.0 (B:1-263) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mmpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrs fglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvv gsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdv vvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldq mierhglkpdyvfnslkdmveal
Timeline for d4jdpb1: