SCOPe 2.08: Domain d4jd7a1: 4jd7 A:1-308

Lineage for d4jd7a1 (4jd7 A:1-308)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:351746] [226612] (2 PDB entries)

8. Domain d4jd7a1: 4jd7 A:1-308 [223749]
   Other proteins in same PDB: d4jd7a2, d4jd7d2
   automated match to d2azpa_
   complexed with so4

Details for d4jd7a1

PDB Entry: 4jd7, 1.5 Å

PDB Description: Crystal structure of pput_1285, a putative hydroxyproline epimerase from Pseudomonas putida f1 (target EFI-506500), open form, space group P212121, bound sulfate

PDB Compounds: (A:) proline racemase

SCOPe Domain Sequences for d4jd7a1:

Sequence; same for both SEQRES and ATOM records:

>d4jd7a1 d.21.1.0 (A:1-308) automated matches {Pseudomonas putida [TaxId: 351746]}
mkqihvidshtggeptrlvmkgfpqlhgrsmaeqrdelrelhdrwrraclleprgndvlv
galycppvsadatcgviffnnagylnmcghgtiglvaslqhlgliapgvhkidtpvgqvs
atlhedgaitvanvpsyryrqhvavnvpghgvvhgdiawggnwfflvaehgqrieldnre
vlteytwamlkaleaqgitgengapidhvelfaddpnadsrnfvmcpgkaydrspcgtgt
saklaclaadgtlaegqtwvqasitgsqfhgryerdgerirpfitgrahmtadstllide
qdpfawgi

Timeline for d4jd7a1:

• d4jd7a1 first appeared in SCOPe 2.03, called d4jd7a_
  
• d4jd7a1 appears in SCOPe 2.07