![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) ![]() |
![]() | Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins) |
![]() | Protein Invasin [49377] (1 species) |
![]() | Species Yersinia pseudotuberculosis [TaxId:633] [49378] (1 PDB entry) |
![]() | Domain d1cwva2: 1cwv A:597-692 [22374] Other proteins in same PDB: d1cwva5 complexed with cit |
PDB Entry: 1cwv (more details), 2.3 Å
SCOPe Domain Sequences for d1cwva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} tiaadkstlaavptsiiadglmastitlelkdtygdpqaganvafdttlgnmgvitdhnd gtysapltsttlgvatvtvkvdgaafsvpsvtvnft
Timeline for d1cwva2:
![]() Domains from same chain: (mouse over for more information) d1cwva1, d1cwva3, d1cwva4, d1cwva5 |