Lineage for d1cwva2 (1cwv A:597-692)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55297Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (1 family) (S)
  5. 55298Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)
  6. 55306Protein Invasin [49377] (1 species)
  7. 55307Species Yersinia pseudotuberculosis [TaxId:633] [49378] (1 PDB entry)
  8. 55309Domain d1cwva2: 1cwv A:597-692 [22374]
    Other proteins in same PDB: d1cwva5

Details for d1cwva2

PDB Entry: 1cwv (more details), 2.3 Å

PDB Description: crystal structure of invasin: a bacterial integrin-binding protein

SCOP Domain Sequences for d1cwva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis}
tiaadkstlaavptsiiadglmastitlelkdtygdpqaganvafdttlgnmgvitdhnd
gtysapltsttlgvatvtvkvdgaafsvpsvtvnft

SCOP Domain Coordinates for d1cwva2:

Click to download the PDB-style file with coordinates for d1cwva2.
(The format of our PDB-style files is described here.)

Timeline for d1cwva2: