Lineage for d1cwva2 (1cwv A:597-692)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764897Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) (S)
  5. 2764898Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)
  6. 2764911Protein Invasin [49377] (1 species)
  7. 2764912Species Yersinia pseudotuberculosis [TaxId:633] [49378] (1 PDB entry)
  8. 2764914Domain d1cwva2: 1cwv A:597-692 [22374]
    Other proteins in same PDB: d1cwva5
    complexed with cit

Details for d1cwva2

PDB Entry: 1cwv (more details), 2.3 Å

PDB Description: crystal structure of invasin: a bacterial integrin-binding protein
PDB Compounds: (A:) invasin

SCOPe Domain Sequences for d1cwva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]}
tiaadkstlaavptsiiadglmastitlelkdtygdpqaganvafdttlgnmgvitdhnd
gtysapltsttlgvatvtvkvdgaafsvpsvtvnft

SCOPe Domain Coordinates for d1cwva2:

Click to download the PDB-style file with coordinates for d1cwva2.
(The format of our PDB-style files is described here.)

Timeline for d1cwva2: