| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) ![]() |
| Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins) |
| Protein Invasin [49377] (1 species) |
| Species Yersinia pseudotuberculosis [TaxId:633] [49378] (1 PDB entry) |
| Domain d1cwva1: 1cwv A:503-596 [22373] Other proteins in same PDB: d1cwva5 complexed with cit |
PDB Entry: 1cwv (more details), 2.3 Å
SCOPe Domain Sequences for d1cwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwva1 b.1.14.1 (A:503-596) Invasin {Yersinia pseudotuberculosis [TaxId: 633]}
ltltaavigdgapangktaitveftvadfegkplagqevvittnngalpnkitektdang
varialtnttdgvtvvtaevegqrqsvdthfvkg
Timeline for d1cwva1:
View in 3DDomains from same chain: (mouse over for more information) d1cwva2, d1cwva3, d1cwva4, d1cwva5 |