SCOPe 2.03: Domain d1e5ui1: 1e5u I:1-89

Lineage for d1e5ui1 (1e5u I:1-89)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families)

5. Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)

6. Protein Intimin [49375] (1 species)

7. Species Escherichia coli [TaxId:562] [49376] (3 PDB entries)
   an enteropathogenic serotype

8. Domain d1e5ui1: 1e5u I:1-89 [22372]
   Other proteins in same PDB: d1e5ui2

Details for d1e5ui1

PDB Entry: 1e5u

PDB Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli

PDB Compounds: (I:) intimin

SCOPe Domain Sequences for d1e5ui1:

Sequence; same for both SEQRES and ATOM records:

>d1e5ui1 b.1.14.1 (I:1-89) Intimin {Escherichia coli [TaxId: 562]}
tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
tlkekgtttisvissdnqtatytiatpns

Timeline for d1e5ui1:

• d1e5ui1 first appeared (with stable ids) in SCOP 1.55
  
• d1e5ui1 appears in SCOPe 2.02
  
• d1e5ui1 appears in SCOPe 2.04
  
• d1e5ui1 appears in the current release, SCOPe 2.08