Lineage for d1e5ui1 (1e5u I:1-89)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111500Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (1 family) (S)
  5. 1111501Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)
  6. 1111502Protein Intimin [49375] (1 species)
  7. 1111503Species Escherichia coli [TaxId:562] [49376] (3 PDB entries)
    an enteropathogenic serotype
  8. 1111508Domain d1e5ui1: 1e5u I:1-89 [22372]
    Other proteins in same PDB: d1e5ui2

Details for d1e5ui1

PDB Entry: 1e5u (more details)

PDB Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
PDB Compounds: (I:) intimin

SCOPe Domain Sequences for d1e5ui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5ui1 b.1.14.1 (I:1-89) Intimin {Escherichia coli [TaxId: 562]}
tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
tlkekgtttisvissdnqtatytiatpns

SCOPe Domain Coordinates for d1e5ui1:

Click to download the PDB-style file with coordinates for d1e5ui1.
(The format of our PDB-style files is described here.)

Timeline for d1e5ui1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5ui2