| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) ![]() |
| Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins) |
| Protein Intimin [49375] (1 species) |
| Species Escherichia coli [TaxId:562] [49376] (5 PDB entries) an enteropathogenic serotype |
| Domain d1e5ui1: 1e5u I:1-89 [22372] Other proteins in same PDB: d1e5ui2 |
PDB Entry: 1e5u (more details)
SCOPe Domain Sequences for d1e5ui1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5ui1 b.1.14.1 (I:1-89) Intimin {Escherichia coli [TaxId: 562]}
tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
tlkekgtttisvissdnqtatytiatpns
Timeline for d1e5ui1: