Lineage for d4jcqo_ (4jcq O:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113250Species Listeria monocytogenes [TaxId:169963] [226688] (2 PDB entries)
  8. 2113265Domain d4jcqo_: 4jcq O: [223717]
    automated match to d3q7ha_

Details for d4jcqo_

PDB Entry: 4jcq (more details), 2 Å

PDB Description: ClpP1 from Listeria monocytogenes
PDB Compounds: (O:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4jcqo_:

Sequence, based on SEQRES records: (download)

>d4jcqo_ c.14.1.0 (O:) automated matches {Listeria monocytogenes [TaxId: 169963]}
iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvqgqsteieie
akeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk

Sequence, based on observed residues (ATOM records): (download)

>d4jcqo_ c.14.1.0 (O:) automated matches {Listeria monocytogenes [TaxId: 169963]}
iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk

SCOPe Domain Coordinates for d4jcqo_:

Click to download the PDB-style file with coordinates for d4jcqo_.
(The format of our PDB-style files is described here.)

Timeline for d4jcqo_: