SCOPe 2.03: Domain d1f02i2: 1f02 I:753-841

Lineage for d1f02i2 (1f02 I:753-841)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families)

5. Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)

6. Protein Intimin [49375] (1 species)

7. Species Escherichia coli [TaxId:562] [49376] (3 PDB entries)
   an enteropathogenic serotype

8. Domain d1f02i2: 1f02 I:753-841 [22371]
   Other proteins in same PDB: d1f02i3, d1f02t_

Details for d1f02i2

PDB Entry: 1f02, 2.9 Å

PDB Description: crystal structure of c-terminal 282-residue fragment of intimin in complex with translocated intimin receptor (tir) intimin-binding domain

PDB Compounds: (I:) intimin

SCOPe Domain Sequences for d1f02i2:

Sequence; same for both SEQRES and ATOM records:

>d1f02i2 b.1.14.1 (I:753-841) Intimin {Escherichia coli [TaxId: 562]}
tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
tlkekgtttisvissdnqtatytiatpns

Timeline for d1f02i2:

• d1f02i2 first appeared (with stable ids) in SCOP 1.55
  
• d1f02i2 appears in SCOPe 2.02
  
• d1f02i2 appears in SCOPe 2.04
  
• d1f02i2 appears in the current release, SCOPe 2.08