Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (1 family) |
Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins) |
Protein Intimin [49375] (1 species) |
Species Escherichia coli [TaxId:562] [49376] (3 PDB entries) an enteropathogenic serotype |
Domain d1f02i2: 1f02 I:753-841 [22371] Other proteins in same PDB: d1f02i3, d1f02t_ |
PDB Entry: 1f02 (more details), 2.9 Å
SCOPe Domain Sequences for d1f02i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f02i2 b.1.14.1 (I:753-841) Intimin {Escherichia coli [TaxId: 562]} tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv tlkekgtttisvissdnqtatytiatpns
Timeline for d1f02i2: