Lineage for d4jcqf_ (4jcq F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853805Species Listeria monocytogenes [TaxId:169963] [226688] (2 PDB entries)
  8. 2853811Domain d4jcqf_: 4jcq F: [223708]
    automated match to d3q7ha_

Details for d4jcqf_

PDB Entry: 4jcq (more details), 2 Å

PDB Description: ClpP1 from Listeria monocytogenes
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4jcqf_:

Sequence, based on SEQRES records: (download)

>d4jcqf_ c.14.1.0 (F:) automated matches {Listeria monocytogenes [TaxId: 169963]}
iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvqgqsteieie
akeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk

Sequence, based on observed residues (ATOM records): (download)

>d4jcqf_ c.14.1.0 (F:) automated matches {Listeria monocytogenes [TaxId: 169963]}
iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk

SCOPe Domain Coordinates for d4jcqf_:

Click to download the PDB-style file with coordinates for d4jcqf_.
(The format of our PDB-style files is described here.)

Timeline for d4jcqf_: