SCOPe 2.03: Domain d1f02i1: 1f02 I:658-752

Lineage for d1f02i1 (1f02 I:658-752)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families)

5. Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)

6. Protein Intimin [49375] (1 species)

7. Species Escherichia coli [TaxId:562] [49376] (3 PDB entries)
   an enteropathogenic serotype

8. Domain d1f02i1: 1f02 I:658-752 [22370]
   Other proteins in same PDB: d1f02i3, d1f02t_

Details for d1f02i1

PDB Entry: 1f02, 2.9 Å

PDB Description: crystal structure of c-terminal 282-residue fragment of intimin in complex with translocated intimin receptor (tir) intimin-binding domain

PDB Compounds: (I:) intimin

SCOPe Domain Sequences for d1f02i1:

Sequence; same for both SEQRES and ATOM records:

>d1f02i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli [TaxId: 562]}
asiteikadkttavangqdaitytvkvmkgdkpvsnqevtftttlgklsnstektdtngy
akvtltsttpgkslvsarvsdvavdvkapevefft

Timeline for d1f02i1:

• d1f02i1 first appeared (with stable ids) in SCOP 1.55
  
• d1f02i1 appears in SCOPe 2.02
  
• d1f02i1 appears in SCOPe 2.04
  
• d1f02i1 appears in the current release, SCOPe 2.08