| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein automated matches [226881] (8 species) not a true protein |
| Species Haloarcula marismortui [TaxId:2238] [225147] (4 PDB entries) |
| Domain d4jcob1: 4jco B:22-162 [223697] Other proteins in same PDB: d4jcoa2, d4jcob2, d4jcoc2, d4jcod2 automated match to d1o6za1 complexed with cl, na |
PDB Entry: 4jco (more details), 1.7 Å
SCOPe Domain Sequences for d4jcob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jcob1 c.2.1.5 (B:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig
Timeline for d4jcob1: