Lineage for d1f00i1 (1f00 I:658-752)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10305Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (1 family) (S)
  5. 10306Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)
  6. 10307Protein Intimin [49375] (1 species)
  7. 10308Species Escherichia coli [TaxId:562] [49376] (3 PDB entries)
  8. 10309Domain d1f00i1: 1f00 I:658-752 [22368]
    Other proteins in same PDB: d1f00i3

Details for d1f00i1

PDB Entry: 1f00 (more details), 1.9 Å

PDB Description: crystal structure of c-terminal 282-residue fragment of enteropathogenic e. coli intimin

SCOP Domain Sequences for d1f00i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f00i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli}
asiteikadkttavangqdaitytvkvmkgdkpvsnqevtftttlgklsnstektdtngy
akvtltsttpgkslvsarvsdvavdvkapevefft

SCOP Domain Coordinates for d1f00i1:

Click to download the PDB-style file with coordinates for d1f00i1.
(The format of our PDB-style files is described here.)

Timeline for d1f00i1: