SCOPe 2.06: Domain d4jboa_: 4jbo A:

Lineage for d4jboa_ (4jbo A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
   OPK group; AIRK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [90039] (62 PDB entries)

8. Domain d4jboa_: 4jbo A: [223677]
   automated match to d3fdna_
   complexed with wph

Details for d4jboa_

PDB Entry: 4jbo, 2.49 Å

PDB Description: Novel Aurora kinase inhibitors reveal mechanisms of HURP in nucleation of centrosomal and kinetochore microtubules

PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d4jboa_:

Sequence; same for both SEQRES and ATOM records:

>d4jboa_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtdlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitansskps

Timeline for d4jboa_:

• d4jboa_ first appeared in SCOPe 2.03
  
• d4jboa_ appears in SCOPe 2.05
  
• d4jboa_ appears in SCOPe 2.07
  
• d4jboa_ appears in the current release, SCOPe 2.08