Lineage for d4jbea_ (4jbe A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909834Species Saccharomonospora viridis [TaxId:471857] [226623] (1 PDB entry)
  8. 2909835Domain d4jbea_: 4jbe A: [223675]
    automated match to d1vlua_
    complexed with bme, ca, cl, edo, mes

Details for d4jbea_

PDB Entry: 4jbe (more details), 1.95 Å

PDB Description: 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
PDB Compounds: (A:) Gamma-glutamyl phosphate reductase

SCOPe Domain Sequences for d4jbea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jbea_ c.82.1.0 (A:) automated matches {Saccharomonospora viridis [TaxId: 471857]}
nevakaveecaraaksaapslsgapdtaidaalesmadrllahrdavlaanaediakaea
ggmsaglldrltitesrltdmadqlrllagaphpqrtvelstldgglrlverrrpvgvig
anyearpnvtvdvasqlvksrnagvlrtgsaalksaqrllevvirpaltdsgidanvvql
vprpereaagalvrlpdlvplvilrgsgestralaleaaqhgvrtlahadgggvlyvdek
adrdtvrslvvnsldrlgvcnrlnlllihdavyeefwpvvsealaergvspslppydhpi
gyewaldsereatvtvarvdgvaeavrianeetsglaagiatedaraaeeffdgyqgtgv
fwnaptrlldgfkllgvpetginldkvpgprgpvtypdlyvrqyavlpver

SCOPe Domain Coordinates for d4jbea_:

Click to download the PDB-style file with coordinates for d4jbea_.
(The format of our PDB-style files is described here.)

Timeline for d4jbea_: