SCOPe 2.05: Domain d4jbda_: 4jbd A:

Lineage for d4jbda_ (4jbd A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (13 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:351746] [226612] (2 PDB entries)

8. Domain d4jbda_: 4jbd A: [223674]
   automated match to d2azpa_
   complexed with cit

Details for d4jbda_

PDB Entry: 4jbd, 1.3 Å

PDB Description: Crystal structure of Pput_1285, a putative hydroxyproline epimerase from Pseudomonas putida f1 (target EFI-506500), open form, space group I2, bound citrate

PDB Compounds: (A:) proline racemase

SCOPe Domain Sequences for d4jbda_:

Sequence; same for both SEQRES and ATOM records:

>d4jbda_ d.21.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 351746]}
mkqihvidshtggeptrlvmkgfpqlhgrsmaeqrdelrelhdrwrraclleprgndvlv
galycppvsadatcgviffnnagylnmcghgtiglvaslqhlgliapgvhkidtpvgqvs
atlhedgaitvanvpsyryrqhvavnvpghgvvhgdiawggnwfflvaehgqrieldnre
vlteytwamlkaleaqgitgengapidhvelfaddpnadsrnfvmcpgkaydrspcgtgt
saklaclaadgtlaegqtwvqasitgsqfhgryerdgerirpfitgrahmtadstllide
qdpfawgi

Timeline for d4jbda_:

• d4jbda_ first appeared in SCOPe 2.03
  
• d4jbda_ appears in SCOPe 2.04
  
• d4jbda_ appears in SCOPe 2.06
  
• d4jbda_ appears in the current release, SCOPe 2.08