SCOPe 2.06: Domain d1dfxa1: 1dfx A:37-125

Lineage for d1dfxa1 (1dfx A:37-125)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [49372] (1 PDB entry)

8. Domain d1dfxa1: 1dfx A:37-125 [22367]
   Other proteins in same PDB: d1dfxa2
   complexed with ca, fe

Details for d1dfxa1

PDB Entry: 1dfx, 1.9 Å

PDB Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774

PDB Compounds: (A:) desulfoferrodoxin

SCOPe Domain Sequences for d1dfxa1:

Sequence; same for both SEQRES and ATOM records:

>d1dfxa1 b.1.13.1 (A:37-125) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
vegstdgamekhvpviekvdggylikvgsvphpmeekhwiewielladgrsytkflkpgd
apeaffaidaskvtareycnlhghwkaen

Timeline for d1dfxa1:

• d1dfxa1 first appeared (with stable ids) in SCOP 1.55, called d1dfx_1
  
• d1dfxa1 appears in SCOPe 2.05
  
• d1dfxa1 appears in SCOPe 2.07
  
• d1dfxa1 appears in the current release, SCOPe 2.08