| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
| Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
| Protein Desulfoferrodoxin C-terminal domain [49371] (2 species) |
| Species Desulfovibrio desulfuricans [TaxId:876] [49372] (1 PDB entry) |
| Domain d1dfxa1: 1dfx A:37-125 [22367] Other proteins in same PDB: d1dfxa2 complexed with ca, fe |
PDB Entry: 1dfx (more details), 1.9 Å
SCOPe Domain Sequences for d1dfxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfxa1 b.1.13.1 (A:37-125) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
vegstdgamekhvpviekvdggylikvgsvphpmeekhwiewielladgrsytkflkpgd
apeaffaidaskvtareycnlhghwkaen
Timeline for d1dfxa1: