Lineage for d1dfxa1 (1dfx A:37-125)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769954Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 1769955Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 1769956Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)
  7. 1769964Species Desulfovibrio desulfuricans [TaxId:876] [49372] (1 PDB entry)
  8. 1769965Domain d1dfxa1: 1dfx A:37-125 [22367]
    Other proteins in same PDB: d1dfxa2
    complexed with ca, fe

Details for d1dfxa1

PDB Entry: 1dfx (more details), 1.9 Å

PDB Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774
PDB Compounds: (A:) desulfoferrodoxin

SCOPe Domain Sequences for d1dfxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfxa1 b.1.13.1 (A:37-125) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
vegstdgamekhvpviekvdggylikvgsvphpmeekhwiewielladgrsytkflkpgd
apeaffaidaskvtareycnlhghwkaen

SCOPe Domain Coordinates for d1dfxa1:

Click to download the PDB-style file with coordinates for d1dfxa1.
(The format of our PDB-style files is described here.)

Timeline for d1dfxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfxa2