Lineage for d1dfx_1 (1dfx 37-125)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10288Superfamily b.1.13: Superoxide reductase-like [49367] (1 family) (S)
  5. 10289Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins)
  6. 10290Protein Desulfoferrodoxin C-terminal domain [49371] (1 species)
  7. 10291Species Desulfovibrio desulfuricans [TaxId:876] [49372] (1 PDB entry)
  8. 10292Domain d1dfx_1: 1dfx 37-125 [22367]
    Other proteins in same PDB: d1dfx_2

Details for d1dfx_1

PDB Entry: 1dfx (more details), 1.9 Å

PDB Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774

SCOP Domain Sequences for d1dfx_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfx_1 b.1.13.1 (37-125) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans}
vegstdgamekhvpviekvdggylikvgsvphpmeekhwiewielladgrsytkflkpgd
apeaffaidaskvtareycnlhghwkaen

SCOP Domain Coordinates for d1dfx_1:

Click to download the PDB-style file with coordinates for d1dfx_1.
(The format of our PDB-style files is described here.)

Timeline for d1dfx_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfx_2