Lineage for d4jaxa1 (4jax A:15-223)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858762Species Kluyveromyces lactis [TaxId:284590] [226650] (1 PDB entry)
  8. 1858763Domain d4jaxa1: 4jax A:15-223 [223660]
    automated match to d1ig8a1
    complexed with gol, po4

Details for d4jaxa1

PDB Entry: 4jax (more details), 2.26 Å

PDB Description: crystal structure of dimeric klhxk1 in crystal form x
PDB Compounds: (A:) hexokinase

SCOPe Domain Sequences for d4jaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jaxa1 c.55.1.0 (A:15-223) automated matches {Kluyveromyces lactis [TaxId: 284590]}
smadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkggnipmipgwvveyp
tgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtgtseqlwsfiakcl
kefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdiegveghdvvpmlqeq
ieklnipinvvalindttgtlvaslytdp

SCOPe Domain Coordinates for d4jaxa1:

Click to download the PDB-style file with coordinates for d4jaxa1.
(The format of our PDB-style files is described here.)

Timeline for d4jaxa1: