Lineage for d1dqkd_ (1dqk D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10288Superfamily b.1.13: Superoxide reductase-like [49367] (1 family) (S)
  5. 10289Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins)
  6. 10293Protein Superoxide reductase (SOR) [49369] (1 species)
  7. 10294Species Pyrococcus furiosus [TaxId:186497] [49370] (3 PDB entries)
  8. 10304Domain d1dqkd_: 1dqk D: [22366]

Details for d1dqkd_

PDB Entry: 1dqk (more details), 2 Å

PDB Description: crystal structure of superoxide reductase in the reduced state at 2.0 angstroms resolution

SCOP Domain Sequences for d1dqkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqkd_ b.1.13.1 (D:) Superoxide reductase (SOR) {Pyrococcus furiosus}
misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg
enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene
vtle

SCOP Domain Coordinates for d1dqkd_:

Click to download the PDB-style file with coordinates for d1dqkd_.
(The format of our PDB-style files is described here.)

Timeline for d1dqkd_: