| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
| Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
| Protein Superoxide reductase (SOR) [49369] (1 species) |
| Species Pyrococcus furiosus [TaxId:2261] [49370] (3 PDB entries) |
| Domain d1dqkc_: 1dqk C: [22365] complexed with fe2 |
PDB Entry: 1dqk (more details), 2 Å
SCOPe Domain Sequences for d1dqkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqkc_ b.1.13.1 (C:) Superoxide reductase (SOR) {Pyrococcus furiosus [TaxId: 2261]}
misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg
enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene
vtle
Timeline for d1dqkc_: