Lineage for d1dqkc_ (1dqk C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764803Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2764804Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 2764815Protein Superoxide reductase (SOR) [49369] (1 species)
  7. 2764816Species Pyrococcus furiosus [TaxId:2261] [49370] (3 PDB entries)
  8. 2764823Domain d1dqkc_: 1dqk C: [22365]
    complexed with fe2

Details for d1dqkc_

PDB Entry: 1dqk (more details), 2 Å

PDB Description: crystal structure of superoxide reductase in the reduced state at 2.0 angstroms resolution
PDB Compounds: (C:) superoxide reductase

SCOPe Domain Sequences for d1dqkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqkc_ b.1.13.1 (C:) Superoxide reductase (SOR) {Pyrococcus furiosus [TaxId: 2261]}
misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg
enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene
vtle

SCOPe Domain Coordinates for d1dqkc_:

Click to download the PDB-style file with coordinates for d1dqkc_.
(The format of our PDB-style files is described here.)

Timeline for d1dqkc_: