Class a: All alpha proteins [46456] (290 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
Protein Citrate synthase [48258] (7 species) |
Species Escherichia coli [TaxId:562] [81862] (12 PDB entries) Uniprot P00891 |
Domain d4jaea_: 4jae A: [223638] complexed with cmc, so4 |
PDB Entry: 4jae (more details), 2.7 Å
SCOPe Domain Sequences for d4jaea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jaea_ a.103.1.1 (A:) Citrate synthase {Escherichia coli [TaxId: 562]} adtkakltldgdtaveldvlkgtlgqdvidirtlgskgvftfdpgftsttsceskitfid gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt agssganpfaciaagiaslwgpahgganeaalkmleeigkkenipefvrrakdkndsfrl mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf ksdikr
Timeline for d4jaea_: