Lineage for d4jadb_ (4jad B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007809Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2007810Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2007811Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2007812Protein Citrate synthase [48258] (7 species)
  7. 2007832Species Escherichia coli [TaxId:562] [81862] (12 PDB entries)
    Uniprot P00891
  8. 2007842Domain d4jadb_: 4jad B: [223637]
    complexed with so4

Details for d4jadb_

PDB Entry: 4jad (more details), 1.9 Å

PDB Description: structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. coli
PDB Compounds: (B:) citrate synthase

SCOPe Domain Sequences for d4jadb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jadb_ a.103.1.1 (B:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltldgdtaveldvlkgtlgqdvidirtlgskgvftfdpgftsttsceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeigkkenipefvrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

SCOPe Domain Coordinates for d4jadb_:

Click to download the PDB-style file with coordinates for d4jadb_.
(The format of our PDB-style files is described here.)

Timeline for d4jadb_: