SCOPe 2.08: Domain d4j93a_: 4j93 A:

Lineage for d4j93a_ (4j93 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d4j93a_: 4j93 A: [223623]
   automated match to d1m9cc_
   complexed with 0oe, 1jr

Details for d4j93a_

PDB Entry: 4j93, 1.74 Å

PDB Description: Crystal Structure of the N-Terminal Domain of HIV-1 Capsid in Complex With Inhibitor BI-1

PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d4j93a_:

Sequence; same for both SEQRES and ATOM records:

>d4j93a_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Timeline for d4j93a_:

• d4j93a_ first appeared in SCOPe 2.03
  
• d4j93a_ appears in SCOPe 2.07