Lineage for d4j89a1 (4j89 A:2-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2940007Domain d4j89a1: 4j89 A:2-231 [223621]
    Other proteins in same PDB: d4j89a2
    automated match to d3ztfa_
    complexed with edo, so4, trs

Details for d4j89a1

PDB Entry: 4j89 (more details), 2.1 Å

PDB Description: Different photochemical events of a genetically encoded aryl azide define and modulate GFP fluorescence
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4j89a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j89a1 d.22.1.1 (A:2-231) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlxvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
elkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyq
qntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d4j89a1:

Click to download the PDB-style file with coordinates for d4j89a1.
(The format of our PDB-style files is described here.)

Timeline for d4j89a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j89a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4j89b_