| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein Green fluorescent protein, GFP [54513] (4 species) |
| Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (151 PDB entries) Uniprot P42212 |
| Domain d4j88b_: 4j88 B: [223620] automated match to d3ztfa_ complexed with edo, so4, trs |
PDB Entry: 4j88 (more details), 2.08 Å
SCOPe Domain Sequences for d4j88b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j88b_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlxvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnrie
lkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyqq
ntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith
Timeline for d4j88b_: